A practical reference on alpha-MSH: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-07-12. Anything still debated is marked as such rather than presented as settled.
Reported pharmacodynamic effects include transient rises in blood pressure and heart rate, flushing, nausea and headache, appearing soon after dosing and resolving within hours. These responses were dose-related in early studies and shaped the label's cardiovascular cautions and blood pressure monitoring advice. Gastrointestinal upset is the most frequent reason cited for discontinuation in trials. Whether the vascular signal attenuates with repeated use is not settled. Central effects on desire are described as emerging over weeks rather than immediately, which points to a cumulative rather than acute process.
The compound binds several melanocortin receptor subtypes rather than a single target, with the strongest functional activity reported at MC4R and measurable activity at MC1R, MC3R and MC5R. MC4R populations are dense in hypothalamic nuclei that integrate energy balance, autonomic tone and reproductive behaviour, which is the anatomical basis for the proposed pro-desire effect. Because binding is not subtype-selective, pigmentary and vascular effects accompany central activity. Improving subtype selectivity is an active area of analogue design. Direct causal mapping from receptor occupancy to reported desire change in humans is not fully established.
After subcutaneous dosing, peak plasma concentrations appear within roughly one hour, and elimination is fast, with a half-life on the order of a few hours. Degradation is mainly proteolytic, and at least one circulating fragment retains receptor activity, so parent-drug levels alone do not describe total exposure. Clearance does not depend heavily on hepatic cytochrome enzymes, which lowers the likelihood of common metabolic interaction routes. Data in renal or hepatic impairment are limited. Repeated dosing does not appear to produce marked accumulation given the short half-life.
Identity and purity are usually established with reversed-phase high-performance liquid chromatography combined with mass spectrometry. A gradient of water and acetonitrile containing trifluoroacetic acid is a common mobile phase, and ultraviolet detection near 214 nanometres responds to the peptide backbone. Mass spectrometry confirms the expected molecular mass and helps reveal truncation or oxidation products. Purity is reported as a peak-area percentage, a figure that depends on the wavelength and gradient used, so values from different laboratories are not always directly comparable. Peptide mapping and amino acid analysis provide additional confirmation when required.
Regulatory status varies by jurisdiction, where approved prescription products, compounded preparations and research-grade material are treated as distinct categories with different documentation requirements. Suppliers of research material commonly issue a certificate of analysis listing purity, identity and sometimes endotoxin content. Independent verification by a third-party laboratory is often recommended because self-reported figures are difficult to check. Literature discussions usually state the source, purity and storage conditions of the material used, since these details affect reproducibility. Analysts note that a reported purity figure does not by itself describe biological activity.
Lyophilised peptide is generally held below minus twenty degrees Celsius, protected from light and moisture, because hydrolysis and oxidation accumulate faster at ambient temperature. Once reconstituted, solutions are typically kept between two and eight degrees Celsius and used within a short window defined by the supplier. Repeated freeze-thaw cycles are avoided since they promote aggregation and loss of soluble material. Container material matters as well, because peptides adsorb to certain plastics and glass surfaces at low concentration. Stability figures supplied by a vendor apply only to the specific lot and buffer that were tested.
| Property | Value | Notes |
|---|---|---|
| Primary target | MC4R | Highest reported functional activity |
| Peak plasma time | About 1 hour | Subcutaneous administration |
| Elimination half-life | A few hours | Active fragment may extend effect |
| Main clearance route | Proteolytic degradation | Not cytochrome-dependent |
| Typical assay | LC-MS/MS | Plasma quantification |
Clinical research typically uses randomised, double-blind, placebo-controlled designs. The most common primary endpoint is the desire domain score of the Female Sexual Function Index, sometimes paired with a distress measure. Secondary outcomes include arousal, satisfaction, and event-based counts of satisfying sexual episodes. Across trials, average improvements are modest and individual responses vary widely. Whether benefits persist beyond a few months, and whether they depend on baseline hormone status, remain open questions rather than settled findings.
Melanocortin receptors form a family of five G-protein-coupled receptors designated MC1 through MC5. Bremelanotide binds most strongly at MC4R and MC1R, with weaker activity reported at MC3R and MC5R. MC4R is expressed in hypothalamic nuclei that coordinate energy balance and aspects of sexual behaviour. The prevailing interpretation is that central MC4R activation, rather than peripheral vascular effects alone, drives the reported changes in desire. This account remains partly inferential, since direct receptor-level measurement in living humans is not practical.
Compared with melanotan II, bremelanotide is a smaller cyclic peptide with a more constrained backbone, which affects receptor selectivity and metabolic stability. Published descriptions give a plasma half-life on the order of a few hours after subcutaneous administration, with elimination through hepatic and renal routes and limited plasma protein binding. Central access is inferred from effects observed in animal models, although direct measurement in humans is limited. Handling and storage requirements follow from the peptide backbone, which is susceptible to hydrolysis and oxidation.
The melanocortin system comprises five G protein-coupled receptors, designated MC1 through MC5, that signal mainly through cyclic AMP accumulation. MC1R and MC2R are associated with pigmentation and adrenal steroid production, while MC3R and MC4R are expressed in the central nervous system and influence energy balance and behavior. MC5R appears in exocrine tissues. Natural agonists include alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone, and endogenous antagonists such as agouti-related protein modulate the same sites. This receptor family provides the framework within which bremelanotide activity is described.
Evidence outside the studied population is sparse. Trials have concentrated on premenopausal women with a defined diagnosis, and data for postmenopausal women, men, and people taking interacting medications remain limited. Non-prescription use of the peptide for comparable goals is widespread but is not supported by published controlled data. Observed changes in blood pressure have drawn attention to cardiovascular monitoring during use. The literature generally frames the compound as a targeted receptor agonist rather than a general libido enhancer, and basic questions about mechanism and long-term safety are unresolved.
Bremelanotide functions as an agonist at several melanocortin receptor subtypes, with the strongest functional activity reported at the MC4 subtype. MC4 receptors sit in hypothalamic circuits that influence appetite, energy balance, and components of sexual behaviour. Rodents lacking functional MC4 receptors show altered mating behaviour, which supports a role for this pathway in desire. The precise sequence of events connecting receptor activation to reported human effects remains only partly characterised. Because the same receptor family governs pigmentation and inflammatory signalling, selectivity is a recurring theme in pharmacological discussion.
Clinical programmes in this area have relied mainly on randomised, double-blind, placebo-controlled designs in premenopausal women. Primary endpoints usually combine a validated questionnaire covering desire domains with counts of satisfying sexual events and a separate measure of distress. Reported outcomes show statistically significant but modest average improvement over placebo, with wide individual variation. Adverse events such as nausea, flushing, and headache occur frequently and can limit tolerability. Whether short-term trial gains translate into lasting change for most users is an open question.
How receptor activation translates into a change in desire is not established in detail. Proposed steps include modulation of dopaminergic signalling in reward circuits and downstream effects on autonomic tone. Human data consist mainly of clinical trials measuring self-reported outcomes rather than direct measurements of brain activity or transmitter release. The transient rise in blood pressure sometimes observed after administration is likewise reported consistently but explained only partly by known melanocortin pathways.
Melanocortin receptors form a family of five G-protein-coupled proteins, labelled MC1R through MC5R, that respond to peptides derived from pro-opiomelanocortin. Alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone are the best-known endogenous ligands. The receptors are distributed differently across tissues, so a single agonist can produce effects in the brain, skin, adrenal gland and vasculature. This distribution explains why one peptide can influence both pigmentation and motivated behaviour.
Bremelanotide is a cyclic heptapeptide that binds several melanocortin receptors rather than one. In vitro assays report agonist activity at MC1R, MC3R, MC4R and MC5R, with MC4R generally treated as the subtype most relevant to sexual effects. MC4R is expressed in hypothalamic nuclei involved in appetite, energy balance and motivated behaviour, which provides a plausible route for central action. Selective MC4R agonists studied in animals produce comparable behavioural changes, supporting that interpretation.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
==== Organ development ==== Since serotonin signals resource availability it is not surprising that it affects organ development. Many human and animal studies have shown that nutrition in early life can influence, in adulthood, such things as body fatness, blood lipids, blood pressure, atherosclerosis, behavior, learning, and longevity. Rodent experiment shows that neonatal exposure to SSRIs makes persistent changes in the serotonergic transmission of the brain resulting in behavioral changes, which are reversed by treatment with antidepressants. By treating normal and knockout mice lacking the serotonin transporter with fluoxetine scientists showed that normal emotional reactions in adulthood, like a short latency to escape foot shocks and inclination to explore new environments were dependent on active serotonin transporters during the neonatal period. Human serotonin can also act as a growth factor directly. Liver damage increases cellular expression of 5-HT2A and 5-HT2B receptors, mediating liver compensatory regrowth (see Liver § Liver regeneration) Serotonin present in the blood then stimulates cellular growth to repair liver damage. 5-HT2B receptors also activate osteocytes, which build up bone. However, serotonin also inhibits osteoblasts, through 5-HT1B receptors.
== Mechanotaxis in wound healing == In wound healing, fluid shear stress plays a large role in the mechanotaxis of endothelial cells to the wound site. The inner lining of blood vessels is composed of these endothelial cells, which means that these cells are continuously experiencing fluid shear stress from blood rushing through the vessels. This mechanical stress on the apical side of the endothelial cells leads to integrin signaling, which involves the recruitment of focal adhesion kinase (FAK), Shc, and Crk, and will lead to changes in cell-cell and cell-ECM adhesion. These changes involve lamellipodial protrusions and focal adhesion (FA) formation at the front of the cell, as well as the dismantling of FAs at the rear of the cell, and cause endothelial cells to move in the direction of the flow. Constant laminar flow has been found to improve cell migration in wounds and increases the rate of wound closure.
==== Thermoplastic adhesives ==== These represent the most widespread class of textile adhesives, favored for their low toxicity and ease of application. Products such as Mowilith® DMC2, Vinamul® 3252, Vinnapas® EP1 are used with fragmented silks and friable cellulosics like cotton. Beva® 371 is typically used with painted textiles due to its solubility in white spirits (mineral spirits), which don't damage the painted surface. Lascaux 360HV is favored for highly degraded materials because of its low activation temperature.
Sources: en.wikipedia.org
=== Human genes === Na+/K+ transporting: ATP1A1, ATP1A2, ATP1A3, ATP1A4, ATP1B1, ATP1B2, ATP1B3, ATP1B4 Ca2+ transporting: ATP2A1, ATP2A2, ATP2A3, ATP2B1, ATP2B2, ATP2B3, ATP2B4, ATP2C1, ATP2C2 H+/K+ exchanging: ATP4A H+ transporting, mitochondrial: ATP5F1A, ATP5F1B, ATP5F1C, ATP5C2, ATP5F1D, ATP5F1E, ATP5F1, ATP5MC1, ATP5MC2, ATP5MC3, ATP5PD, ATP5ME, ATP5PF, ATP5MF, ATP5MG, ATP5L2, ATP5PO, ATP5S, MT-ATP6, MT-ATP8 H+ transporting, lysosomal: ATP6AP1, ATP6AP2, ATP6V1A, ATP6V1B1, ATP6V1B2, ATP6V1C1, ATP6V1C2, ATP6V1D, ATP6V1E1, ATP6V1E2, ATP6V1F, ATP6V1G1, ATP6V1G2, ATP6V1G3, ATP6V1H, ATP6V0A1, ATP6V0A2, ATP6V0A4, ATP6V0B, ATP6V0C, ATP6V0D1, ATP6V0D2, ATP6V0E Cu2+ transporting: ATP7A, ATP7B Class I, type 8: ATP8A1, ATP8B1, ATP8B2, ATP8B3, ATP8B4 Class II, type 9: ATP9A, ATP9B Class V, type 10: ATP10A, ATP10B, ATP10D Class VI, type 11: ATP11A, ATP11B, ATP11C H+/K+ transporting, nongastric: ATP12A type 13: ATP13A1, ATP13A2, ATP13A3, ATP13A4, ATP13A5
==== tiab-tiap ==== tiabendazole (INN) tiacrilast (INN) tiadenol (INN) tiafibrate (INN) tiagabine (INN) Tiamate tiamenidine (INN) tiametonium iodide (INN) tiamiprine (INN) tiamizide (INN) Tiamol tiamulin (INN) tianafac (INN) tianeptine (INN) tiapamil (INN) tiapirinol (INN) tiapride (INN) tiaprofenic acid (INN) tiaprost (INN)
== Gastroenterology == In gastroenterology, the term overlap syndrome may be used to describe autoimmune liver diseases that combine characteristic features of autoimmune hepatitis, primary biliary cirrhosis and primary sclerosing cholangitis.
The cap of P. semilanceata is 5–25 mm (0.20–0.98 in) in diameter and 6–22 mm (0.24–0.87 in) tall. It varies in shape from sharply conical to bell-shaped, often with a prominent papilla (a nipple-shaped structure), and does not change shape considerably as it ages. The cap margin is initially rolled inward but unrolls to become straight or even curled upwards in maturity. The cap is hygrophanous, meaning it assumes different colors depending on its state of hydration. When it is moist, the cap is ochraceous to pale brown to dark chestnut brown, but darker in the center, often with a greenish-blue tinge. When moist, radial grooves (striations) can be seen on the cap that correspond to the positions of the gills underneath. When the cap is dry, it becomes much paler, a light yellow-brown color. Moist mushrooms have sticky surfaces that result from a thin gelatinous film called a pellicle. This film becomes apparent if a piece of the cap is broken by bending it back and peeling away the piece. When the cap dries from exposure to the sun, the film turns whitish and is no longer peelable. On the underside of the mushroom's cap, there are between 15 and 27 individual narrow gills that are moderately crowded together, and they have a narrowly adnexed to almost free attachment to the stipe. Their color is initially pale brown, but becomes dark gray to purple-brown with a lighter edge as the spores mature. The slender yellowish-brown stipe is 4.5–14 cm (1.8–5.5 in) long by 1–3.5 mm (0.04–0.14 in) thick, and usually slightly thicker towards the base.
Xi identifies environmental protection as one of China's five major priorities for national progress. Xi has popularized a metaphor of "two mountains" to emphasize the importance of environmental protection. The concept is that a mountain made of gold or silver is valuable, but green mountains with clear waters are more valuable. The slogan's meaning is that economic development priorities must also provide for economic protection. In September 2020, Xi announced that China would "strengthen its 2030 climate target (NDC), peak emissions before 2030 and aim to achieve carbon neutrality before 2060." If accomplished, this would lower the expected rise in global temperature by 0.2–0.3 °C – "the biggest single reduction ever estimated by the Climate Action Tracker." Xi mentioned the link between the COVID-19 pandemic and nature destruction as one of the reasons for the decision, saying that "Humankind can no longer afford to ignore the repeated warnings of nature." On 27 September 2020, Chinese scientists presented a detailed plan how to achieve the target. In September 2021, Xi announced that China will not build "coal-fired power projects abroad", which was said to be potentially "pivotal" in reducing emissions. The Belt and Road Initiative did not include financing such projects in the first half of 2021. Xi did not attend COP26 personally. However, a Chinese delegation led by climate change envoy Xie Zhenhua did attend. During the conference, the United States and China agreed on a framework to reduce GHG emission by co-operating on different measures.
Sources: en.wikipedia.org
The Annals of Clinical & Laboratory Science is a quarterly academic journal. It is the official journal of, and is published by, the Association of Clinical Scientists. It was established in 1971 as Annals of Clinical Laboratory Science by F. William Sunderman and obtained its current title in 1973. As of 2022, the editor-in-chief is Nina Tatevian.
An alcohol treated with at least 3 equivalents of an activated halide (such as allyl bromide or iodomethane) and CDI yields the corresponding halide with good yield. Bromination and iodination work best, though this reaction does not preserve the stereochemistry of the alcohol. In a similar context, CDI is often used in dehydration reactions. As CDI is an equivalent of phosgene, it can be used in similar reaction, however, with increased selectivity: it allows the synthesis of asymmetric bis alkyl carbonates
== Further reading == Farlow, J. O.; Gatesy, S. M.; Holtz, T. R. Jr.; Hutchinson, J. R.; Robinson, J. M. (2000). "Theropod Locomotion". American Zoologist. 40 (4): 640–663. doi:10.1093/icb/40.4.640. JSTOR 3884284.
The dermal papillae (DP; singular papilla, diminutive of Latin papula, 'pimple') are small, nipple-like extensions (or interdigitations) of the dermis into the epidermis. At the surface of the skin in hands and feet, they appear as epidermal, papillary or friction ridges (colloquially known as fingerprints). Note that dermal papilla has two meanings referring to separate anatomical features. The dermal papilla of the dermal–epidermal junction should not be confused with the dermal papilla cells at the base of each hair follicle. The pattern of ridges produced in hands and feet are only partly genetically determined features that are developed before birth, the timing and events around the ridge formation area also contributing. They remain substantially unaltered (except in size) throughout life, and therefore determine the patterns of fingerprints, making them useful in certain functions of personal identification. The dermal papillae are part of the uppermost layer of the dermis, the papillary dermis, and the ridges they form greatly increase the surface area between the dermis and epidermis. Because the main function of the dermis is to support the epidermis, this greatly increases the exchange of oxygen, nutrients, and waste products between these two layers. Additionally, the increase in the surface area prevents the dermal and epidermal layers from separating by strengthening the junction between them. With age, the papillae tend to flatten and sometimes increase in number.
== Structure == Collagen XVII is a homotrimer of three alpha1(XVII)-chains and a transmembrane protein in type II orientation. Each 180 kD a-chain contains a globular intracellular domain of approximately 70 kDa, which interacts with beta4-integrin, plectin, and BP230 and is necessary for the stable attachment of hemidesmosomes to keratin intermediate filaments. The large C-terminal ectodomain with a molecular mass of approximately 120 kDa consists of 15 collagenous subdomains, characterized by typical collagenous G-X-Y repeat sequences, flanked by 16 short non-collagenous stretches. The overall structure of the ectodomain is that of a flexible, rod-like triple helix with a significant thermal stability. The membrane proximal part of the ectodomain, within amino acids 506-519, is responsible for binding to alpha 6 integrin, this binding seems to be important for the collagen XVII integration into hemidesmosomes . The largest collagenous domain, Col15, which contains 232 amino acids (amino acids 567-808), contributes significantly to stability of collagen XVII homotrimer. The C-terminus of collagen XVII binds to laminin 5, and correct integration of laminin 5 into the matrix requires collagen XVII.
Sources: en.wikipedia.org
MC4R is regarded as the primary mediator on the basis of binding and functional assays. Other subtypes are also engaged, which helps explain flushing and related side effects. The step from receptor activation to reported desire change remains partly inferential.
Elimination is rapid, with a half-life of a few hours. An active fragment circulates after breakdown, so biological activity may outlast measurable parent drug. This is one reason single-timepoint measurements are limited.
Because breakdown is mainly proteolytic rather than cytochrome-dependent, classic metabolic interactions are less likely. Agents affecting blood pressure could still matter. Formal interaction studies are sparse.
Purity is normally expressed as a percentage of total peak area from a chromatographic run. The value depends on the column, gradient and detection wavelength chosen. Results generated under different conditions are therefore not always interchangeable.