melanocortin comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-06-18. Where a claim depends on a specific study, the study is described rather than over-claimed.
How receptor activation translates into a change in desire is not established in detail. Proposed steps include modulation of dopaminergic signalling in reward circuits and downstream effects on autonomic tone. Human data consist mainly of clinical trials measuring self-reported outcomes rather than direct measurements of brain activity or transmitter release. The transient rise in blood pressure sometimes observed after administration is likewise reported consistently but explained only partly by known melanocortin pathways.
Melanocortin receptors form a family of five G-protein-coupled proteins, labelled MC1R through MC5R, that respond to peptides derived from pro-opiomelanocortin. Alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone are the best-known endogenous ligands. The receptors are distributed differently across tissues, so a single agonist can produce effects in the brain, skin, adrenal gland and vasculature. This distribution explains why one peptide can influence both pigmentation and motivated behaviour.
Bremelanotide is a cyclic heptapeptide that binds several melanocortin receptors rather than one. In vitro assays report agonist activity at MC1R, MC3R, MC4R and MC5R, with MC4R generally treated as the subtype most relevant to sexual effects. MC4R is expressed in hypothalamic nuclei involved in appetite, energy balance and motivated behaviour, which provides a plausible route for central action. Selective MC4R agonists studied in animals produce comparable behavioural changes, supporting that interpretation.
Regulatory review of bremelanotide concluded in 2019 with approval in the United States for a defined indication in premenopausal women. The reviewed formulation is a single-use prefilled autoinjector given subcutaneously, and its label carries cardiovascular monitoring language tied to blood pressure changes recorded during trials. Availability outside the approving jurisdiction varies, and in several countries the compound remains unapproved or is handled as a prescription-only item. Compounded and research-grade material also circulates, and it differs from the reviewed product in purity, characterization, and chain of custody.
Bremelanotide is a synthetic cyclic heptapeptide developed under the research code PT-141. The code reflects its position in an internal compound series rather than a chemical classification, and the name bremelanotide was later adopted for regulatory filings. Structurally it belongs to the melanocortin peptide family and shares a core sequence motif with alpha-melanocyte-stimulating hormone. The compound is supplied as an acetate salt in aqueous solution for injection. In reference literature it is indexed under both the code and the generic name, a dual listing that can complicate database searches.
Early work on melanocortin analogs in the 1980s and 1990s produced peptides intended to influence pigmentation and appetite. One of these, melanotan II, was observed to affect sexual desire as an incidental finding in self-administration reports. Researchers then pursued analogs with altered receptor selectivity and improved handling characteristics, and PT-141 emerged from that program in the late 1990s. The development path moved from dermatology and metabolism toward a central nervous system application, a shift that shaped both trial designs and the eventual label.
| Property | Value | Notes |
|---|---|---|
| Primary receptor target | MC4R agonist | Subtype most often linked to behavioural effects |
| Other reported targets | MC1R, MC3R, MC5R | Activity is not selective for a single subtype |
| Endogenous ligand class | Melanocortin peptides | Alpha-MSH and ACTH act on the same family |
| Peptide architecture | Cyclic heptapeptide | Lactam bridge between the aspartate and lysine residues |
| Central action | Inferred from animal models | Not directly measured in the human brain |
After subcutaneous dosing, peak plasma concentrations appear within roughly one hour, and elimination is fast, with a half-life on the order of a few hours. Degradation is mainly proteolytic, and at least one circulating fragment retains receptor activity, so parent-drug levels alone do not describe total exposure. Clearance does not depend heavily on hepatic cytochrome enzymes, which lowers the likelihood of common metabolic interaction routes. Data in renal or hepatic impairment are limited. Repeated dosing does not appear to produce marked accumulation given the short half-life.
Reported pharmacodynamic effects include transient rises in blood pressure and heart rate, flushing, nausea and headache, appearing soon after dosing and resolving within hours. These responses were dose-related in early studies and shaped the label's cardiovascular cautions and blood pressure monitoring advice. Gastrointestinal upset is the most frequent reason cited for discontinuation in trials. Whether the vascular signal attenuates with repeated use is not settled. Central effects on desire are described as emerging over weeks rather than immediately, which points to a cumulative rather than acute process.
The compound binds several melanocortin receptor subtypes rather than a single target, with the strongest functional activity reported at MC4R and measurable activity at MC1R, MC3R and MC5R. MC4R populations are dense in hypothalamic nuclei that integrate energy balance, autonomic tone and reproductive behaviour, which is the anatomical basis for the proposed pro-desire effect. Because binding is not subtype-selective, pigmentary and vascular effects accompany central activity. Improving subtype selectivity is an active area of analogue design. Direct causal mapping from receptor occupancy to reported desire change in humans is not fully established.
Across literature and commercial listings, the substance appears under several names, including bremelanotide, PT-141, and various brand designations. A CAS registry number provides a unique identifier for the compound, aiding retrieval from chemical databases. Synonym lists may also contain early development codes and descriptive chemical names. When consulting sources, researchers need to confirm that the cited names refer to the same molecular structure to avoid confusion. Naming consistency matters especially when comparing analytical data across publications.
PT-141 is a synthetic cyclic heptapeptide whose development code is bremelanotide. It belongs to the class of melanocortin receptor agonists and acts by mimicking endogenous peptide hormones. The compound originated from research on melanotan II, where investigators exploring derivatives found distinct pharmacological features. Unlike the parent compound, PT-141 showed effects on pathways related to sexual desire and function in early studies, prompting its development as a separate candidate. Its molecular design aimed to separate receptor activity from pigmentary effects.
Activation of MC4R in the hypothalamus is thought to influence dopaminergic signaling, which in turn affects arousal and desire. This mechanism differs from that of phosphodiesterase type 5 inhibitors, which act primarily on vascular smooth muscle in the genital region. Because the pathway is central rather than peripheral, effects are not strictly dependent on local blood flow. The precise downstream cascade linking receptor binding to behavioral outcomes remains an area of ongoing investigation.
Clinical development of bremelanotide proceeded through several reformulation attempts. An early intranasal version was discontinued, and a subcutaneous auto-injector formulation later received approval for hypoactive sexual desire disorder in premenopausal women. Approval decisions have varied by country and over time, and the product has not been universally adopted. Blood pressure elevation is a documented effect, which is why some jurisdictions require monitoring after administration. The clinical evidence base continues to evolve as additional studies are published.
The melanocortin system comprises five G protein-coupled receptors, designated MC1 through MC5, that signal mainly through cyclic AMP accumulation. MC1R and MC2R are associated with pigmentation and adrenal steroid production, while MC3R and MC4R are expressed in the central nervous system and influence energy balance and behavior. MC5R appears in exocrine tissues. Natural agonists include alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone, and endogenous antagonists such as agouti-related protein modulate the same sites. This receptor family provides the framework within which bremelanotide activity is described.
Bremelanotide acts as an agonist at several melanocortin receptors, with the strongest reported activity at MC4R and measurable activity at MC1R and MC3R. Because MC4R is expressed in hypothalamic and limbic circuits, the proposed mechanism links receptor activation to modulation of central pathways involved in desire rather than to direct effects on peripheral genital tissue. The precise downstream steps remain incompletely characterized, and evidence for the involvement of specific neurotransmitters is suggestive rather than settled. Nausea and blood pressure elevation reported during trials are consistent with melanocortin signaling outside the intended target circuit.
The most common peptide aptamer selection system is the yeast two-hybrid system. Peptide aptamers can also be selected from combinatorial peptide libraries constructed by phage display and other surface display technologies such as mRNA display, ribosome display, bacterial display and yeast display. These experimental procedures are also known as biopanning. All the peptides panned from combinatorial peptide libraries have been stored in the MimoDB database.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Banting House is a museum and former residence in London, Ontario, Canada. Known as the “Birthplace of Insulin,” it is the house where Sir Frederick Banting woke up at two o'clock in the morning on October 31, 1920 with the idea that led to the discovery of insulin. Since 1984, the house has been a museum dedicated to Banting's discovery and his life. An addition at the back houses the London & District Branch of the Canadian Diabetes Association. For many that have been touched by diabetes, the house is an emotional reminder of Banting's scientific contribution that saved their lives or the lives of their loved ones.
oil/fat {\displaystyle {{\textrm {W}}_{\textrm {oil/fat}}}} is the weight of sample, in g. For example, standard methods for determination of SV of vegetable and animal fats are as follows: The SV can also be calculated from the fatty acid composition as determined by gas chromatography (AOCS Cd 3a-94). Handmade soap makers who aim for bar soap use sodium hydroxide (NaOH), commonly known as lye, rather than KOH (caustic potash) which produces soft paste, gel or liquid soaps. In order to calculate the lye amount needed to make bar soap, KOH values of SV can be converted to NaOH values by dividing KOH values by the ratio of the molecular weights of KOH and NaOH (1.403). The theoretical SV of a pure triglyceride molecule can be calculated by the following equation (where MW is its molecular weight):
AM concentrations are substantially elevated during intense inflammation from disorders like sepsis, rendering AM a potentially viable therapeutic agent and clinical mode of monitoring such inflammation. AM contributes to vasodilation, which could be detrimental in leading to septic shock. Researchers seek to mitigate this effect while maintaining ADM's antimicrobial, anti-inflammatory, and endothelial-protective characteristics by employing antibodies that bind to ADM's N-terminus or co-administering ADM with ADM-binding protein-1, which collectively extend ADM's half-life and increase its maintenance role while minimizing this detrimental vasodilation. While AM has been discussed in regard to its implications for bacterial infections, such as sepsis, prior research explores its potential connection to viral infections too. This annunciates the importance of continual investigation into AM's mechanisms with viral illnesses through exploring its roles in inflammation and immune regulation.
Sources: en.wikipedia.org
A common SNP in the BDNF gene is rs6265. This point mutation in the coding sequence, a guanine to adenine switch at position 196, results in an amino acid switch: valine to methionine exchange at codon 66, Val66Met, which is in the prodomain of BDNF. Val66Met is unique to humans. The mutation interferes with normal translation and intracellular trafficking of BDNF mRNA, as it destabilizes the mRNA and renders it prone to degradation. The proteins resulting from mRNA that does get translated, are not trafficked and secreted normally, as the amino acid change occurs on the portion of the prodomain where sortilin binds; and sortilin is essential for normal trafficking. The Val66Met mutation results in a reduction of hippocampal tissue and has since been reported in a high number of individuals with learning and memory disorders, anxiety disorders, major depression, and neurodegenerative diseases such as Alzheimer's and Parkinson's. A meta-analysis indicates that the BDNF Val66Met variant is not associated with serum BDNF.
Introduced in 2007, ChIP sequencing (ChIP-seq) is a technology that uses chromatin immunoprecipitation to crosslink the proteins of interest to the DNA but then instead of using a micro-array, it uses the more accurate, higher throughput method of sequencing to localize interaction points. DamID is an alternative method that does not require antibodies. ChIP-exo uses exonuclease treatment to achieve up to single base pair resolution. CUT&RUN sequencing uses antibody recognition with targeted enzymatic cleavage to address some technical limitations of ChIP.
As of 2020, normal ALP levels were "not well defined", and there tend to be variations by sex and racial background, and by age, with children and adolescents having markedly higher levels. There are many possible explanations for elevated ALP. When the cause is unclear, isoenzyme studies using electrophoresis can confirm the source of the increase. Skelphosphatase (which is localized in osteoblasts and extracellular layers of newly synthesized matrix) is released into circulation by a yet unclear mechanism. Placental alkaline phosphatase is elevated in seminomas and active forms of rickets, as well as in the following diseases and conditions: Biliary obstruction Bone conditions Osteoblastic bone tumors Osteomalacia Osteoporosis Hepatitis Mononucleosis Cirrhosis Acute cholecystitis Myelofibrosis Leukemoid reaction Congestive heart failure Lymphoma Paget's disease Sarcoidosis Hyperthyroidism Hyperparathyroidism Myocardial infarction Cholangitis Ischemic cholangiopathy Pregnancy High doses of estrogens
A microbial electrolysis cell (MEC) is a technology related to Microbial fuel cells (MFC). Whilst MFCs produce an electric current from the microbial decomposition of organic compounds, MECs partially reverse the process to generate hydrogen or methane from organic material by applying an electric current. The electric current would ideally be produced by a renewable source of power. The hydrogen or methane produced can be used to produce electricity by means of an additional PEM fuel cell or internal combustion engine.
Sources: en.wikipedia.org
By 1951, Alec Todd and collaborators at the University of Cambridge had determined by biochemical methods how the backbone of DNA is structured via the successive linking of carbon atoms 3 and 5 of the sugar to phosphates. This would help to corroborate Watson and Crick's later X-ray structural work. Todd would later be awarded the 1957 Nobel Prize in Chemistry for this and other discoveries related to DNA. Late in 1951, Francis Crick started working with James Watson at the Cavendish Laboratory within the University of Cambridge. DNA's role in heredity was confirmed in 1952 when Alfred Hershey and Martha Chase in the Hershey–Chase experiment showed that DNA is the genetic material of the enterobacteria phage T2.
Ansuvimab, sold under the brand name Ebanga, is a monoclonal antibody medication used for the treatment of Ebolavirus (Zaire ebolavirus) infection. The most common symptoms include fever, tachycardia (fast heart rate), diarrhea, vomiting, hypotension (low blood pressure), tachypnea (fast breathing) and chills; however, these are also common symptoms of Ebolavirus infection. Ansuvimab was approved for medical use in the United States in December 2020. It is on the World Health Organization's List of Essential Medicines. Ansuvimab is composed of a single monoclonal antibody (mAb) and was initially isolated from immortalized B-cells that were obtained from a survivor of the 1995 outbreak of Ebola virus disease in Kikwit, Democratic Republic of the Congo. In work supported by the United States National Institutes of Health and the Defense Advanced Projects Agency, the heavy and light chain sequences of ansuvimab mAb were cloned into Chinese hamster ovary cell lines and initial production runs were produced by Cook Phamica d.b.a. Catalent under contract with Medimmune.
S-Arrestin is a protein found in mice that binds to rhodopsin to stop its activity, preventing further signaling. S-arrestin binds to G protein-coupled receptors (GPCRs), like rhodopsin, following receptor activation and phosphorylation by G protein-coupled receptor kinases (GRKs). Rhodopsin is found in rod cells of the retina, essential for vision. It detects light and initiates a signaling cascade called phototransduction. However, excessive activation can be harmful, so it must be carefully regulated. The phosphorylation of the receptor's intracellular loops and C-terminal tail creates a high-affinity binding site for S-arrestin. S-arrestin then sterically hinders further G protein coupling, effectively desensitizing the receptor and directing it towards alternative signaling pathways or internalization via clathrin-mediated endocytosis.
Agents that "bind" to the toxin can reduce free or active toxin present. It is possible for this binding to be nonspecific or specific. Activated charcoal is the non-specific binding agent most frequently utilised as it has strong adsorption capacity and could prevent the toxin's enterohepatic recirculation. Chelation agents, immunotherapy, and bioscavenger therapy are examples of specific binders. Urinary alkalization or hemadsorption may improve elimination in some circumstances.
Oligonucleotides are chemically synthesized using building blocks called nucleoside phosphoramidites. These can be normal or modified nucleosides which have protecting groups to prevent their amines, hydroxyl groups and phosphate groups from interacting incorrectly. One phosphoramidite is added at a time, the 5' hydroxyl group is deprotected and a new base is added and so on. The chain grows in the 3' to 5' direction, which is backwards relative to biosynthesis. At the end, all the protecting groups are removed. Nevertheless, being a chemical process, several incorrect interactions occur leading to some defective products. The longer the oligonucleotide sequence that is being synthesized, the more defects there are, thus this process is only practical for producing short sequences of nucleotides. The current practical limit is about 200 bp (base pairs) for an oligonucleotide with sufficient quality to be used directly for a biological application. HPLC can be used to isolate products with the proper sequence. Meanwhile, a large number of oligos can be synthesized in parallel on gene chips. For optimal performance in subsequent gene synthesis procedures they should be prepared individually and in larger scales.
Sources: en.wikipedia.org
Bremelanotide binds several melanocortin receptors, and MC4R is the subtype most often cited as responsible for its behavioural effects. Activity at MC1R, MC3R and MC5R is also reported. Selectivity is therefore described as limited rather than precise.
It is not classified as a vasodilator, and its proposed site of action is the central nervous system rather than peripheral vessels. Some trial participants show small transient blood pressure changes. Whether those changes arise centrally or through another route remains an open question.
Most evidence comes from animal models and from indirect human outcomes such as self-reported desire. Direct measurements of receptor occupancy or signalling in the human brain are not available. Published reviews therefore present a plausible pathway rather than a confirmed sequence of events.
PT-141 was the internal development code assigned to bremelanotide during preclinical research. Reference sources sometimes index the peptide under the code rather than the generic name. The two terms describe the same molecule.